Lineage for d3fqfa_ (3fqf A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618684Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1618685Protein automated matches [190777] (17 species)
    not a true protein
  7. 1618872Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)
  8. 1618876Domain d3fqfa_: 3fqf A: [175976]
    automated match to d1ddra_
    complexed with 55v, ndp; mutant

Details for d3fqfa_

PDB Entry: 3fqf (more details), 1.77 Å

PDB Description: staphylococcus aureus f98y mutant dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]- 6-methylpyrimidine (ucp115a)
PDB Compounds: (A:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3fqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fqfa_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d3fqfa_:

Click to download the PDB-style file with coordinates for d3fqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3fqfa_: