SCOPe 2.05: Domain d3fqfa_: 3fqf A:

Lineage for d3fqfa_ (3fqf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [188831] (12 PDB entries)

8. Domain d3fqfa_: 3fqf A: [175976]
   automated match to d1ddra_
   complexed with 55v, ndp; mutant

Details for d3fqfa_

PDB Entry: 3fqf, 1.77 Å

PDB Description: staphylococcus aureus f98y mutant dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3,4,5-trimethoxyphenyl)pent-1-ynyl]- 6-methylpyrimidine (ucp115a)

PDB Compounds: (A:) Trimethoprim-sensitive dihydrofolate reductase

SCOPe Domain Sequences for d3fqfa_:

Sequence; same for both SEQRES and ATOM records:

>d3fqfa_ c.71.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 273036]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3fqfa_:

• d3fqfa_ first appeared in SCOPe 2.01
  
• d3fqfa_ appears in SCOPe 2.04
  
• d3fqfa_ appears in SCOPe 2.06
  
• d3fqfa_ appears in the current release, SCOPe 2.08