SCOPe 2.05: Domain d3fooa_: 3foo A:

Lineage for d3fooa_ (3foo A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (34 PDB entries)

8. Domain d3fooa_: 3foo A: [175935]
   automated match to d1qq3a_
   complexed with hem, ni, pxx

Details for d3fooa_

PDB Entry: 3foo, 2.4 Å

PDB Description: a triangular cytochrome b562 superstructure mediated by ni coordination - monoclinic form

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d3fooa_:

Sequence; same for both SEQRES and ATOM records:

>d3fooa_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d3fooa_:

• d3fooa_ first appeared in SCOPe 2.01
  
• d3fooa_ appears in SCOPe 2.04
  
• d3fooa_ appears in SCOPe 2.06
  
• d3fooa_ appears in the current release, SCOPe 2.08