Lineage for d1bayb1 (1bay B:79-209)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735942Protein Class pi GST [81347] (4 species)
  7. 1736063Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)
  8. 1736071Domain d1bayb1: 1bay B:79-209 [17593]
    Other proteins in same PDB: d1baya2, d1bayb2

Details for d1bayb1

PDB Entry: 1bay (more details), 2 Å

PDB Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme
PDB Compounds: (B:) glutathione s-transferase class pi

SCOPe Domain Sequences for d1bayb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bayb1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d1bayb1:

Click to download the PDB-style file with coordinates for d1bayb1.
(The format of our PDB-style files is described here.)

Timeline for d1bayb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bayb2