SCOPe 2.07: Domain d3fifg1: 3fif G:2-53

Lineage for d3fifg1 (3fif G:2-53)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
   Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals

6. Protein automated matches [191017] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188787] (1 PDB entry)

8. Domain d3fifg1: 3fif G:2-53 [175829]
   Other proteins in same PDB: d3fifa2, d3fifb2, d3fifc2, d3fifd2, d3fife2, d3fiff2, d3fifg2, d3fifh2
   automated match to d2jn0a1

Details for d3fifg1

PDB Entry: 3fif, 2.7 Å

PDB Description: Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.

PDB Compounds: (G:) Uncharacterized lipoprotein ygdR

SCOPe Domain Sequences for d3fifg1:

Sequence; same for both SEQRES and ATOM records:

>d3fifg1 b.38.1.6 (G:2-53) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiier

Timeline for d3fifg1:

• d3fifg1 first appeared in SCOPe 2.01, called d3fifg_
  
• d3fifg1 appears in SCOPe 2.06
  
• d3fifg1 appears in the current release, SCOPe 2.08