PDB entry 3fif

View 3fif on RCSB PDB site
Description: Crystal structure of the ygdR protein from E.coli. Northeast Structural Genomics target ER382A.
Class: structural genomics, unknown function
Keywords: ygdR YGDR_ECOLI NESG X-RAY STRUCTURE, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Cell membrane, Lipoprotein, Membrane, Palmitate, unknown function
Deposited on 2008-12-11, released 2009-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (Start-52)
      • expression tag (53-56)
    Domains in SCOPe 2.07: d3fifa1, d3fifa2
  • Chain 'B':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-56)
    Domains in SCOPe 2.07: d3fifb1, d3fifb2
  • Chain 'C':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-57)
    Domains in SCOPe 2.07: d3fifc1, d3fifc2
  • Chain 'D':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-57)
    Domains in SCOPe 2.07: d3fifd1, d3fifd2
  • Chain 'E':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-56)
    Domains in SCOPe 2.07: d3fife1, d3fife2
  • Chain 'F':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-56)
    Domains in SCOPe 2.07: d3fiff1, d3fiff2
  • Chain 'G':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-57)
    Domains in SCOPe 2.07: d3fifg1, d3fifg2
  • Chain 'H':
    Compound: Uncharacterized lipoprotein ygdR
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ygdR, b2833, JW2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65294 (1-52)
      • expression tag (53-56)
    Domains in SCOPe 2.07: d3fifh1, d3fifh2
  • Chain 'Y':
    Compound: Uncharacterized ligand
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FIF (0-6)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fifA (A:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifA (A:)
    sdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fifB (B:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifB (B:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fifC (C:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifC (C:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fifD (D:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifD (D:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fifE (E:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifE (E:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdamqinrddvsqiierlehh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fifF (F:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifF (F:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fifG (G:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifG (G:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fifH (H:)
    mssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgnamqinrddvsqiierlehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fifH (H:)
    ssdyvmatkdgrmiltdgkpeidddtglvsyhdqqgamqinrddvsqiierlehh
    

  • Chain 'Y':
    No sequence available.