Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Pteropus giganteus [TaxId:143291] [188768] (1 PDB entry) |
Domain d3fh9b_: 3fh9 B: [175782] automated match to d1aj9b_ complexed with hem, oxy |
PDB Entry: 3fh9 (more details), 1.62 Å
SCOPe Domain Sequences for d3fh9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fh9b_ a.1.1.2 (B:) automated matches {Pteropus giganteus [TaxId: 143291]} vhlsgeekaavtglwgkvkvdevggealgrllvvypwtqrffdsfgdlssasavmgnpkv kahgkkvldsfseglqhldnlkgtfaklselhcdklhvdpenfrllgnvlvcvlarhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d3fh9b_: