| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries) |
| Domain d3ff7a1: 3ff7 A:1-99 [175740] Other proteins in same PDB: d3ff7a2, d3ff7b2, d3ff7c_, d3ff7d_ automated match to d1o6sb_ complexed with acy |
PDB Entry: 3ff7 (more details), 1.8 Å
SCOPe Domain Sequences for d3ff7a1:
Sequence, based on SEQRES records: (download)
>d3ff7a1 b.1.6.1 (A:1-99) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwl
kvtepldreriatytlfshavssngnavedpmeilitvt
>d3ff7a1 b.1.6.1 (A:1-99) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippislpkgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvt
epldreriatytlfshavssngnavedpmeilitvt
Timeline for d3ff7a1:
View in 3DDomains from other chains: (mouse over for more information) d3ff7b1, d3ff7b2, d3ff7c_, d3ff7d_ |