SCOPe 2.08: Domain d3ff7a1: 3ff7 A:1-99

Lineage for d3ff7a1 (3ff7 A:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d3ff7a1: 3ff7 A:1-99 [175740]
   Other proteins in same PDB: d3ff7a2, d3ff7b2, d3ff7c_, d3ff7d_
   automated match to d1o6sb_
   complexed with acy

Details for d3ff7a1

PDB Entry: 3ff7, 1.8 Å

PDB Description: structure of nk cell receptor klrg1 bound to e-cadherin

PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d3ff7a1:

Sequence, based on SEQRES records:

>d3ff7a1 b.1.6.1 (A:1-99) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippislpenekgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwl
kvtepldreriatytlfshavssngnavedpmeilitvt

Sequence, based on observed residues (ATOM records):

>d3ff7a1 b.1.6.1 (A:1-99) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
dwvippislpkgpfpknlvqiksnkdkegkvfysitgqgadtppvgvfiieretgwlkvt
epldreriatytlfshavssngnavedpmeilitvt

Timeline for d3ff7a1:

• d3ff7a1 first appeared in SCOPe 2.01, called d3ff7a_
  
• d3ff7a1 appears in SCOPe 2.07