Lineage for d3feyb_ (3fey B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558742Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 2558743Species Human (Homo sapiens) [TaxId:9606] [64275] (7 PDB entries)
  8. 2558745Domain d3feyb_: 3fey B: [175737]
    Other proteins in same PDB: d3feyc1, d3feyc2
    automated match to d1h2ux_
    protein/RNA complex

Details for d3feyb_

PDB Entry: 3fey (more details), 2.2 Å

PDB Description: Crystal structure of the CBC-importin alpha complex.
PDB Compounds: (B:) Nuclear cap-binding protein subunit 2

SCOPe Domain Sequences for d3feyb_:

Sequence, based on SEQRES records: (download)

>d3feyb_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgdikkiim
gldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqyg

Sequence, based on observed residues (ATOM records): (download)

>d3feyb_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dsyveeqekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldtacgfcfveyy
sradaenamryingtrlddriirtdwdagfkegrqyg

SCOPe Domain Coordinates for d3feyb_:

Click to download the PDB-style file with coordinates for d3feyb_.
(The format of our PDB-style files is described here.)

Timeline for d3feyb_: