SCOPe 2.01: Domain d3feyb_: 3fey B:

Lineage for d3feyb_ (3fey B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)

8. Domain d3feyb_: 3fey B: [175737]
   automated match to d1h2ux_
   protein/RNA complex

Details for d3feyb_

PDB Entry: 3fey, 2.2 Å

PDB Description: Crystal structure of the CBC-importin alpha complex.

PDB Compounds: (B:) Nuclear cap-binding protein subunit 2

SCOPe Domain Sequences for d3feyb_:

Sequence, based on SEQRES records:

>d3feyb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgdikkiim
gldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqyg

Sequence, based on observed residues (ATOM records):

>d3feyb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dsyveeqekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldtacgfcfveyy
sradaenamryingtrlddriirtdwdagfkegrqyg

Timeline for d3feyb_:

• d3feyb_ is new in SCOPe 2.01-stable
  
• d3feyb_ appears in SCOPe 2.02
  
• d3feyb_ appears in the current release, SCOPe 2.08