SCOPe 2.02: Domain d3feua_: 3feu A:

Lineage for d3feua_ (3feu A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (50 species)
   not a true protein

7. Species Vibrio fischeri [TaxId:312309] [188754] (1 PDB entry)

8. Domain d3feua_: 3feu A: [175736]
   automated match to d1beda_
   complexed with mg

Details for d3feua_

PDB Entry: 3feu, 1.76 Å

PDB Description: Crystal Structure of DsbA-like thioredoxin domain VF_A0457 from Vibrio fischeri

PDB Compounds: (A:) Putative lipoprotein

SCOPe Domain Sequences for d3feua_:

Sequence; same for both SEQRES and ATOM records:

>d3feua_ c.47.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
adpkegvqyevlstslendgmapvtevfalscghcrnmenflpvisqeagtdigkmhitf
nqsahiasmfyyaaemqvdgapdhafmedlfaatqmgegttlteqqeayskaftsrglvs
pydfneeqrdtlikkvdnakmlseksgissvptfvvngkynvligghddpkqiadtiryl
lek

Timeline for d3feua_:

• d3feua_ first appeared in SCOPe 2.01
  
• d3feua_ appears in SCOPe 2.03
  
• d3feua_ appears in the current release, SCOPe 2.08, called d3feua1