Lineage for d11gsb1 (11gs B:77-209)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1735942Protein Class pi GST [81347] (4 species)
  7. 1735943Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1736062Domain d11gsb1: 11gs B:77-209 [17569]
    Other proteins in same PDB: d11gsa2, d11gsb2
    complexed with eaa, gsh, mes

Details for d11gsb1

PDB Entry: 11gs (more details), 2.3 Å

PDB Description: Glutathione s-transferase complexed with ethacrynic acid-glutathione conjugate (form ii)
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d11gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d11gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d11gsb1:

Click to download the PDB-style file with coordinates for d11gsb1.
(The format of our PDB-style files is described here.)

Timeline for d11gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d11gsb2