| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (30 species) not a true protein |
| Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries) |
| Domain d3f90e_: 3f90 E: [175582] automated match to d1j9ea_ complexed with fmn |
PDB Entry: 3f90 (more details), 2.5 Å
SCOPe Domain Sequences for d3f90e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f90e_ c.23.5.0 (E:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg
medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia
eglkmegdasndpeavasfaedvlkql
Timeline for d3f90e_: