Lineage for d3f90e_ (3f90 E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116062Species Desulfovibrio desulfuricans [TaxId:876] [188896] (3 PDB entries)
  8. 2116078Domain d3f90e_: 3f90 E: [175582]
    automated match to d1j9ea_
    complexed with fmn

Details for d3f90e_

PDB Entry: 3f90 (more details), 2.5 Å

PDB Description: desulfovibrio desulfuricans (atcc 29577) semiquinone flavodoxin
PDB Compounds: (E:) flavodoxin

SCOPe Domain Sequences for d3f90e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f90e_ c.23.5.0 (E:) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
skvlivfgsstgntesiaqkleeliaagghevtllnaadasaenladgydavlfgcsawg
medlemqddflslfeefdriglagrkvaafasgdqeyehfcgavpaieerakelgatiia
eglkmegdasndpeavasfaedvlkql

SCOPe Domain Coordinates for d3f90e_:

Click to download the PDB-style file with coordinates for d3f90e_.
(The format of our PDB-style files is described here.)

Timeline for d3f90e_: