Lineage for d3f8jb_ (3f8j B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2433042Family b.122.1.12: SRA domain-like [159368] (2 proteins)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2433043Protein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species)
  7. 2433052Species Mouse (Mus musculus) [TaxId:10090] [159371] (10 PDB entries)
    Uniprot Q8VDF2 405-613! Uniprot Q8VDF2 418-625
  8. 2433061Domain d3f8jb_: 3f8j B: [175572]
    automated match to d2zo0b1
    protein/DNA complex; complexed with gol

Details for d3f8jb_

PDB Entry: 3f8j (more details), 1.99 Å

PDB Description: Mouse UHRF1 SRA domain bound with hemi-methylated CpG, crystal structure in space group C222(1)
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3f8jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f8jb_ b.122.1.12 (B:) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]}
ivpanhfgpipgvpvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvd
ngnyftytgsggrdlsgnkrtagqssdqkltnnnralalnchspinekgaeaedwrqgkp
vrvvrnmkggkhskyapaegnrydgiykvvkywpergksgflvwryllrrddtepepwtr
egkdrtrqlgltmqypegylealank

SCOPe Domain Coordinates for d3f8jb_:

Click to download the PDB-style file with coordinates for d3f8jb_.
(The format of our PDB-style files is described here.)

Timeline for d3f8jb_: