SCOPe 2.01: Domain d3f8ba_: 3f8b A:

Lineage for d3f8ba_ (3f8b A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (14 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:416870] [188710] (1 PDB entry)

8. Domain d3f8ba_: 3f8b A: [175565]
   automated match to d1xmab_

Details for d3f8ba_

PDB Entry: 3f8b, 2 Å

PDB Description: Crystal structure of the multidrug binding transcriptional regulator LmrR in drug free state

PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d3f8ba_:

Sequence, based on SEQRES records:

>d3f8ba_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlean

Sequence, based on observed residues (ATOM records):

>d3f8ba_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdgrrkyyrlteighenmrlafeswsrvdkiienlean

Timeline for d3f8ba_:

• d3f8ba_ is new in SCOPe 2.01-stable
  
• d3f8ba_ appears in SCOPe 2.02
  
• d3f8ba_ appears in the current release, SCOPe 2.08