Lineage for d19gsb1 (19gs B:77-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915887Protein Class pi GST [81347] (4 species)
  7. 915888Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)
  8. 915963Domain d19gsb1: 19gs B:77-209 [17547]
    Other proteins in same PDB: d19gsa2, d19gsb2
    complexed with bsp, gsh, mes

Details for d19gsb1

PDB Entry: 19gs (more details), 1.9 Å

PDB Description: Glutathione s-transferase p1-1
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d19gsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d19gsb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d19gsb1:

Click to download the PDB-style file with coordinates for d19gsb1.
(The format of our PDB-style files is described here.)

Timeline for d19gsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d19gsb2