SCOPe 2.02: Domain d3f1oa_: 3f1o A:

Lineage for d3f1oa_ (3f1o A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (7 PDB entries)

8. Domain d3f1oa_: 3f1o A: [175411]
   Other proteins in same PDB: d3f1ob_
   automated match to d1p97a_
   complexed with 2xy, edo

Details for d3f1oa_

PDB Entry: 3f1o, 1.6 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with an internally-bound artificial ligand

PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d3f1oa_:

Sequence, based on SEQRES records:

>d3f1oa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

Sequence, based on observed residues (ATOM records):

>d3f1oa_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviynpqcimcvnyvlseiek

Timeline for d3f1oa_:

• d3f1oa_ first appeared in SCOPe 2.01
  
• d3f1oa_ appears in SCOPe 2.03
  
• d3f1oa_ appears in the current release, SCOPe 2.08, called d3f1oa1