PDB entry 3f1o

View 3f1o on RCSB PDB site
Description: Crystal structure of the high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS domains, with an internally-bound artificial ligand
Class: transcription
Keywords: PAS domain, heterodimer, internal cavity, Activator, Angiogenesis, Congenital erythrocytosis, Developmental protein, Differentiation, Disease mutation, DNA-binding, Hydroxylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Alternative splicing, Polymorphism
Deposited on 2008-10-28, released 2009-01-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1, HIF2A, Hypoxia Inducible Factor 2 alpha, MOP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (5-End)
      • expression tag (2-4)
      • engineered (13)
    Domains in SCOPe 2.02: d3f1oa_
  • Chain 'B':
    Compound: Aryl hydrocarbon receptor nuclear translocator
    Species: Homo sapiens [TaxId:9606]
    Gene: ARNT, Aryl Hydrocarbon Receptor Nuclear Translocator
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27540
      • engineered (12)
    Domains in SCOPe 2.02: d3f1ob_
  • Heterogens: 2XY, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3f1oA (A:)
gefkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtksh
qnlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

    Sequence, based on observed residues (ATOM records): (download) 
    >3f1oA (A:)
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviynpqcimcvnyvlseiek

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3f1oB (B:)
gefkglnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllr
dsfqqvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknssq
e

    Sequence, based on observed residues (ATOM records): (download) 
    >3f1oB (B:)
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknss