SCOPe 2.08: Domain d3f01a1: 3f01 A:140-265

Lineage for d3f01a1 (3f01 A:140-265)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)

8. Domain d3f01a1: 3f01 A:140-265 [175369]
   Other proteins in same PDB: d3f01a2
   automated match to d1byna_
   complexed with cu, so4

Details for d3f01a1

PDB Entry: 3f01, 1.7 Å

PDB Description: crystal structure of synaptotagmin i c2a domain with cu(ii)

PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d3f01a1:

Sequence; same for both SEQRES and ATOM records:

>d3f01a1 b.7.1.2 (A:140-265) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsa

Timeline for d3f01a1:

• d3f01a1 first appeared in SCOPe 2.01, called d3f01a_
  
• d3f01a1 appears in SCOPe 2.07