![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
![]() | Domain d3f01a1: 3f01 A:140-265 [175369] Other proteins in same PDB: d3f01a2 automated match to d1byna_ complexed with cu, so4 |
PDB Entry: 3f01 (more details), 1.7 Å
SCOPe Domain Sequences for d3f01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f01a1 b.7.1.2 (A:140-265) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]} eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew rdlqsa
Timeline for d3f01a1: