PDB entry 3f01

View 3f01 on RCSB PDB site
Description: Crystal Structure of Synaptotagmin I C2A domain with Cu(II)
Class: metal binding protein
Keywords: Synaptotagmin I, C2A, copper, Calcium, Cell junction, Cytoplasmic vesicle, Glycoprotein, Lipoprotein, Membrane, Metal-binding, Palmitate, Phosphoprotein, Synapse, Transmembrane, METAL BINDING PROTEIN
Deposited on 2008-10-24, released 2009-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Synaptotagmin-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SYT1, SVP65, SYT
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21579 (17-142)
    • expression tag (0-16)
  Domains in SCOPe 2.08: d3f01a1, d3f01a2
• Heterogens: SO4, CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f01A (A:)
  gspgiggggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
  vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
  fkvpmntvdfghvteewrdlqsa