SCOPe 2.01: Domain d3f01a_: 3f01 A:

Lineage for d3f01a_ (3f01 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [158946] (5 PDB entries)

8. Domain d3f01a_: 3f01 A: [175369]
   automated match to d1byna_
   complexed with cu, so4

Details for d3f01a_

PDB Entry: 3f01, 1.7 Å

PDB Description: crystal structure of synaptotagmin i c2a domain with cu(ii)

PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d3f01a_:

Sequence; same for both SEQRES and ATOM records:

>d3f01a_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
gspgiggggggildsmveklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvk
vfllpdkkkkfetkvhrktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiige
fkvpmntvdfghvteewrdlqsa

Timeline for d3f01a_:

• d3f01a_ is new in SCOPe 2.01-stable
  
• d3f01a_ appears in SCOPe 2.02
  
• d3f01a_ appears in the current release, SCOPe 2.08, called d3f01a1