SCOPe 2.07: Domain d3ezqo1: 3ezq O:223-335

Lineage for d3ezqo1 (3ezq O:223-335)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
   Pfam PF00531

6. Protein automated matches [190466] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188706] (5 PDB entries)

8. Domain d3ezqo1: 3ezq O:223-335 [175339]
   Other proteins in same PDB: d3ezqa2, d3ezqb_, d3ezqc2, d3ezqd_, d3ezqe2, d3ezqf_, d3ezqg2, d3ezqh_, d3ezqi2, d3ezqj_, d3ezqk2, d3ezql_, d3ezqm2, d3ezqn_, d3ezqo2, d3ezqp_
   automated match to d1ddfa_
   complexed with na, so4

Details for d3ezqo1

PDB Entry: 3ezq, 2.73 Å

PDB Description: Crystal Structure of the Fas/FADD Death Domain Complex

PDB Compounds: (O:) Tumor necrosis factor receptor superfamily member 6

SCOPe Domain Sequences for d3ezqo1:

Sequence; same for both SEQRES and ATOM records:

>d3ezqo1 a.77.1.2 (O:223-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv

Timeline for d3ezqo1:

• d3ezqo1 first appeared in SCOPe 2.01, called d3ezqo_
  
• d3ezqo1 appears in SCOPe 2.06
  
• d3ezqo1 appears in the current release, SCOPe 2.08