| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
| Protein automated matches [190466] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188706] (6 PDB entries) |
| Domain d3ezqo1: 3ezq O:223-335 [175339] Other proteins in same PDB: d3ezqa2, d3ezqb_, d3ezqc2, d3ezqd_, d3ezqe2, d3ezqf_, d3ezqg2, d3ezqh_, d3ezqi2, d3ezqj_, d3ezqk2, d3ezql_, d3ezqm2, d3ezqn_, d3ezqo2, d3ezqp_ automated match to d1ddfa_ complexed with na, so4 |
PDB Entry: 3ezq (more details), 2.73 Å
SCOPe Domain Sequences for d3ezqo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezqo1 a.77.1.2 (O:223-335) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsdvdlskyittiagvmtlsqvkgfvrkngvneakideikndnvqdtaeqkvqllrnwh
qlhgkkeaydtlikdlkkanlctlaekiqtiilkditsdsensnfrneiqslv
Timeline for d3ezqo1: