Lineage for d1aqvb1 (1aqv B:77-209)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491918Protein Class pi GST [81347] (4 species)
  7. 1491919Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1491951Domain d1aqvb1: 1aqv B:77-209 [17533]
    Other proteins in same PDB: d1aqva2, d1aqvb2
    complexed with 0hg, mes

Details for d1aqvb1

PDB Entry: 1aqv (more details), 1.94 Å

PDB Description: glutathione s-transferase in complex with p-bromobenzylglutathione
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1aqvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqvb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1aqvb1:

Click to download the PDB-style file with coordinates for d1aqvb1.
(The format of our PDB-style files is described here.)

Timeline for d1aqvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqvb2