![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47619] (67 PDB entries) |
![]() | Domain d1aqvb1: 1aqv B:77-209 [17533] Other proteins in same PDB: d1aqva2, d1aqvb2 complexed with 0hg, mes |
PDB Entry: 1aqv (more details), 1.94 Å
SCOPe Domain Sequences for d1aqvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqvb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d1aqvb1: