Lineage for d1aqvb1 (1aqv B:77-209)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356194Protein Class pi GST [81347] (3 species)
  7. 356195Species Human (Homo sapiens) [TaxId:9606] [47619] (36 PDB entries)
  8. 356216Domain d1aqvb1: 1aqv B:77-209 [17533]
    Other proteins in same PDB: d1aqva2, d1aqvb2
    complexed with ilg, mes, pbb

Details for d1aqvb1

PDB Entry: 1aqv (more details), 1.94 Å

PDB Description: glutathione s-transferase in complex with p-bromobenzylglutathione

SCOP Domain Sequences for d1aqvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqvb1 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens)}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOP Domain Coordinates for d1aqvb1:

Click to download the PDB-style file with coordinates for d1aqvb1.
(The format of our PDB-style files is described here.)

Timeline for d1aqvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqvb2