Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.232: Mago nashi protein [89816] (1 superfamily) beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234 |
Superfamily d.232.1: Mago nashi protein [89817] (1 family) automatically mapped to Pfam PF02792 |
Family d.232.1.1: Mago nashi protein [89818] (1 protein) |
Protein Mago nashi protein [89819] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries) |
Domain d3ex7a_: 3ex7 A: [175285] automated match to d1p27a_ protein/RNA complex; complexed with adp, af3, mg |
PDB Entry: 3ex7 (more details), 2.3 Å
SCOPe Domain Sequences for d3ex7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ex7a_ d.232.1.1 (A:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]} sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf yylvqdlkclvfsliglhfkikpi
Timeline for d3ex7a_: