SCOPe 2.04: Domain d3ex7a_: 3ex7 A:

Lineage for d3ex7a_ (3ex7 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.232: Mago nashi protein [89816] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234

4. Superfamily d.232.1: Mago nashi protein [89817] (1 family)
   automatically mapped to Pfam PF02792

5. Family d.232.1.1: Mago nashi protein [89818] (1 protein)

6. Protein Mago nashi protein [89819] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)

8. Domain d3ex7a_: 3ex7 A: [175285]
   automated match to d1p27a_
   protein/RNA complex; complexed with adp, af3, mg

Details for d3ex7a_

PDB Entry: 3ex7, 2.3 Å

PDB Description: The crystal structure of EJC in its transition state

PDB Compounds: (A:) Protein mago nashi homolog

SCOPe Domain Sequences for d3ex7a_:

Sequence; same for both SEQRES and ATOM records:

>d3ex7a_ d.232.1.1 (A:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
sdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkr
iiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvf
yylvqdlkclvfsliglhfkikpi

Timeline for d3ex7a_:

• d3ex7a_ first appeared in SCOPe 2.01
  
• d3ex7a_ appears in SCOPe 2.03
  
• d3ex7a_ appears in SCOPe 2.05
  
• d3ex7a_ appears in the current release, SCOPe 2.08