Lineage for d8gssc1 (8gss C:77-209)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915887Protein Class pi GST [81347] (4 species)
  7. 915888Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)
  8. 915955Domain d8gssc1: 8gss C:77-209 [17523]
    Other proteins in same PDB: d8gssa2, d8gssb2, d8gssc2
    complexed with gsh, mes, so4

Details for d8gssc1

PDB Entry: 8gss (more details), 1.9 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione
PDB Compounds: (C:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d8gssc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8gssc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d8gssc1:

Click to download the PDB-style file with coordinates for d8gssc1.
(The format of our PDB-style files is described here.)

Timeline for d8gssc1: