Lineage for d3eszb_ (3esz B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein automated matches [190443] (6 species)
not a true protein
Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries) 
Domain d3eszb_: 3esz B: [175208]
automated match to d1rcfa_
complexed with fmn, gol, mg
Details for d3eszb_
PDB Entry: 3esz (more details), 1.94 Å
PDB Description: k2ak3a flavodoxin from anabaena
PDB Compounds: (B:) flavodoxinSCOPe Domain Sequences for d3eszb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eszb_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
aaiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOPe Domain Coordinates for d3eszb_:
Click to download the PDB-style file with coordinates for d3eszb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eszb_:
- d3eszb_ first appeared in SCOPe 2.01
- d3eszb_ appears in SCOPe 2.05
- d3eszb_ appears in SCOPe 2.07
- d3eszb_ appears in the current release, SCOPe 2.08
View in 3D
