SCOPe 2.05: Domain d3eszb_: 3esz B:

Lineage for d3eszb_ (3esz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein automated matches [190443] (4 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries)

8. Domain d3eszb_: 3esz B: [175208]
   automated match to d1rcfa_
   complexed with fmn, gol, mg

Details for d3eszb_

PDB Entry: 3esz, 1.94 Å

PDB Description: k2ak3a flavodoxin from anabaena

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d3eszb_:

Sequence; same for both SEQRES and ATOM records:

>d3eszb_ c.23.5.1 (B:) automated matches {Anabaena sp. [TaxId: 1168]}
aaiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

Timeline for d3eszb_:

• d3eszb_ first appeared in SCOPe 2.01
  
• d3eszb_ appears in SCOPe 2.04
  
• d3eszb_ appears in SCOPe 2.06
  
• d3eszb_ appears in the current release, SCOPe 2.08