Lineage for d3erwc_ (3erw C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169725Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1169726Protein automated matches [190056] (50 species)
    not a true protein
  7. 1169743Species Bacillus subtilis [TaxId:1423] [188752] (2 PDB entries)
  8. 1169748Domain d3erwc_: 3erw C: [175179]
    automated match to d1st9a_

Details for d3erwc_

PDB Entry: 3erw (more details), 2.5 Å

PDB Description: Crystal Structure of StoA from Bacillus subtilis
PDB Compounds: (C:) Sporulation thiol-disulfide oxidoreductase A

SCOPe Domain Sequences for d3erwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erwc_ c.47.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
avflmktiegedisipnkgqktilhfwtswcppckkelpqfqsfydahpsdsvklvtvnl
vnseqnqqvvedfikankltfpivldskgelmkeyhiitiptsfllnekgeiektkigpm
taeqlkewte

SCOPe Domain Coordinates for d3erwc_:

Click to download the PDB-style file with coordinates for d3erwc_.
(The format of our PDB-style files is described here.)

Timeline for d3erwc_: