SCOPe 2.07: Domain d3epyb_: 3epy B:

Lineage for d3epyb_ (3epy B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
   automatically mapped to Pfam PF00887

6. Protein automated matches [190551] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)

8. Domain d3epyb_: 3epy B: [175153]
   automated match to d1acaa_
   complexed with coa, plm

Details for d3epyb_

PDB Entry: 3epy, 2.01 Å

PDB Description: crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa

PDB Compounds: (B:) Acyl-CoA-binding domain-containing protein 7

SCOPe Domain Sequences for d3epyb_:

Sequence; same for both SEQRES and ATOM records:

>d3epyb_ a.11.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqadfdraaedvrklkarpddgelkelyglykqaivgdiniacpgmldlkgkakweawnl
kkglstedatsayiskakeliekygi

Timeline for d3epyb_:

• d3epyb_ first appeared in SCOPe 2.01
  
• d3epyb_ appears in SCOPe 2.06
  
• d3epyb_ appears in the current release, SCOPe 2.08