Lineage for d3epyb_ (3epy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697427Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 2697428Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 2697441Protein automated matches [190551] (1 species)
    not a true protein
  7. 2697442Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)
  8. 2697447Domain d3epyb_: 3epy B: [175153]
    automated match to d1acaa_
    complexed with coa, plm

Details for d3epyb_

PDB Entry: 3epy (more details), 2.01 Å

PDB Description: crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
PDB Compounds: (B:) Acyl-CoA-binding domain-containing protein 7

SCOPe Domain Sequences for d3epyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3epyb_ a.11.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqadfdraaedvrklkarpddgelkelyglykqaivgdiniacpgmldlkgkakweawnl
kkglstedatsayiskakeliekygi

SCOPe Domain Coordinates for d3epyb_:

Click to download the PDB-style file with coordinates for d3epyb_.
(The format of our PDB-style files is described here.)

Timeline for d3epyb_: