SCOPe 2.02: Domain d3epya_: 3epy A:

Lineage for d3epya_ (3epy A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families)

5. Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)

6. Protein automated matches [190551] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)

8. Domain d3epya_: 3epy A: [175152]
   automated match to d1acaa_
   complexed with coa, plm

Details for d3epya_

PDB Entry: 3epy, 2 Å

PDB Description: crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa

PDB Compounds: (A:) Acyl-CoA-binding domain-containing protein 7

SCOPe Domain Sequences for d3epya_:

Sequence; same for both SEQRES and ATOM records:

>d3epya_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malqadfdraaedvrklkarpddgelkelyglykqaivgdiniacpgmldlkgkakweaw
nlkkglstedatsayiskakeliekygi

Timeline for d3epya_:

• d3epya_ first appeared in SCOPe 2.01
  
• d3epya_ appears in SCOPe 2.03
  
• d3epya_ appears in the current release, SCOPe 2.08