Lineage for d3epya_ (3epy A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262003Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1262004Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1262005Family a.11.1.1: Acyl-CoA binding protein [47028] (2 proteins)
    automatically mapped to Pfam PF00887
  6. 1262018Protein automated matches [190551] (1 species)
    not a true protein
  7. 1262019Species Human (Homo sapiens) [TaxId:9606] [187531] (3 PDB entries)
  8. 1262023Domain d3epya_: 3epy A: [175152]
    automated match to d1acaa_
    complexed with coa, plm

Details for d3epya_

PDB Entry: 3epy (more details), 2 Å

PDB Description: crystal structure of human acyl-coa binding domain 7 complexed with palmitoyl-coa
PDB Compounds: (A:) Acyl-CoA-binding domain-containing protein 7

SCOPe Domain Sequences for d3epya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3epya_ a.11.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malqadfdraaedvrklkarpddgelkelyglykqaivgdiniacpgmldlkgkakweaw
nlkkglstedatsayiskakeliekygi

SCOPe Domain Coordinates for d3epya_:

Click to download the PDB-style file with coordinates for d3epya_.
(The format of our PDB-style files is described here.)

Timeline for d3epya_: