Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins) automatically mapped to Pfam PF00145 |
Protein DNA methylase HhaI [53367] (2 species) |
Species Haemophilus parahaemolyticus [TaxId:735] [187136] (7 PDB entries) |
Domain d3eeoa_: 3eeo A: [174901] automated match to d10mha_ protein/DNA complex; complexed with sam |
PDB Entry: 3eeo (more details), 1.94 Å
SCOPe Domain Sequences for d3eeoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eeoa_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus parahaemolyticus [TaxId: 735]} mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk qfgnsvvinvlqyiaynigsslnfkpy
Timeline for d3eeoa_: