PDB entry 3eeo

View 3eeo on RCSB PDB site
Description: M. HhaI co-crystallized with synthetic dsDNA containing a propane diol in place of the deoxycytidine residue targeted for methylation.
Class: transferase/DNA
Keywords: Protein-DNA complex with S-adenosylmethionine co-factor and propane diol in place of targeted cytosine., Methyltransferase, Restriction system, S-adenosyl-L-methionine, Transferase, TRANSFERASE-DNA COMPLEX
Deposited on 2008-09-05, released 2010-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.239
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus parahaemolyticus [TaxId:735]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3eeoa_
  • Chain 'C':
    Compound: 5'-d(p*dcp*dcp*dap*dtp*dgp*dcp*dgp*dcp*dtp*dgp*dap*dc)-3'
  • Chain 'D':
    Compound: 5'-d(p*dgp*dtp*dcp*dap*dgp*(pdi)p*dgp*dcp*dap*dtp*dgp*dg)-3'
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3eeoA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.