SCOPe 2.05: Domain d3ee9a_: 3ee9 A:

Lineage for d3ee9a_ (3ee9 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (6 species)
   not a true protein

7. Species Influenza a virus (a/udorn/307/1972(h3n2)) [TaxId:381517] [188730] (2 PDB entries)

8. Domain d3ee9a_: 3ee9 A: [174885]
   automated match to d2gx9a1
   complexed with so4

Details for d3ee9a_

PDB Entry: 3ee9, 2.14 Å

PDB Description: structure of ns1 effector domain

PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d3ee9a_:

Sequence; same for both SEQRES and ATOM records:

>d3ee9a_ d.299.1.1 (A:) automated matches {Influenza a virus (a/udorn/307/1972(h3n2)) [TaxId: 381517]}
tpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfaw
gs

Timeline for d3ee9a_:

• d3ee9a_ first appeared in SCOPe 2.01
  
• d3ee9a_ appears in SCOPe 2.04
  
• d3ee9a_ appears in SCOPe 2.06
  
• d3ee9a_ appears in the current release, SCOPe 2.08