Lineage for d3ee9b_ (3ee9 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947558Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1947559Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1947560Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1947565Protein automated matches [190936] (6 species)
    not a true protein
  7. 1947566Species Influenza a virus (a/udorn/307/1972(h3n2)) [TaxId:381517] [188730] (2 PDB entries)
  8. 1947568Domain d3ee9b_: 3ee9 B: [174886]
    automated match to d2gx9a1
    complexed with so4

Details for d3ee9b_

PDB Entry: 3ee9 (more details), 2.14 Å

PDB Description: structure of ns1 effector domain
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3ee9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ee9b_ d.299.1.1 (B:) automated matches {Influenza a virus (a/udorn/307/1972(h3n2)) [TaxId: 381517]}
sryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletlil
lrafteegaivgeisplpsfpghtiedvknaigvligglewndntvrvsktlqrfawg

SCOPe Domain Coordinates for d3ee9b_:

Click to download the PDB-style file with coordinates for d3ee9b_.
(The format of our PDB-style files is described here.)

Timeline for d3ee9b_: