| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.299: Ns1 effector domain-like [143020] (1 superfamily) beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7] |
Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) ![]() automatically mapped to Pfam PF00600 |
| Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins) C-terminal part of Pfam PF00600 |
| Protein Non-structural protein NS1 C-terminal domain [143023] (1 species) |
| Species Influenza A virus [TaxId:11320] [143024] (1 PDB entry) Uniprot Q71QT3 79-205 |
| Domain d2gx9a1: 2gx9 A:79-205 [135828] complexed with scn |
PDB Entry: 2gx9 (more details), 2.1 Å
SCOPe Domain Sequences for d2gx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gx9a1 d.299.1.1 (A:79-205) Non-structural protein NS1 C-terminal domain {Influenza A virus [TaxId: 11320]}
mtmasvpasryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvif
drletlillrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetl
qrfawrs
Timeline for d2gx9a1: