Lineage for d2gx9b_ (2gx9 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947558Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1947559Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1947560Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1947561Protein Non-structural protein NS1 C-terminal domain [143023] (1 species)
  7. 1947562Species Influenza A virus [TaxId:11320] [143024] (1 PDB entry)
    Uniprot Q71QT3 79-205
  8. 1947564Domain d2gx9b_: 2gx9 B: [135829]
    automated match to d2gx9a1
    complexed with scn

Details for d2gx9b_

PDB Entry: 2gx9 (more details), 2.1 Å

PDB Description: x-ray structure of influenza virus ns1 effector domain
PDB Compounds: (B:) NS1 Effector Domain

SCOPe Domain Sequences for d2gx9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gx9b_ d.299.1.1 (B:) Non-structural protein NS1 C-terminal domain {Influenza A virus [TaxId: 11320]}
asryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawrs
sn

SCOPe Domain Coordinates for d2gx9b_:

Click to download the PDB-style file with coordinates for d2gx9b_.
(The format of our PDB-style files is described here.)

Timeline for d2gx9b_: