SCOPe 2.08: Domain d2gx9b_: 2gx9 B:

Lineage for d2gx9b_ (2gx9 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein Non-structural protein NS1 C-terminal domain [143023] (1 species)

7. Species Influenza A virus, different strains [TaxId:11320] [143024] (1 PDB entry)
   Uniprot Q71QT3 79-205

8. Domain d2gx9b_: 2gx9 B: [135829]
   automated match to d2gx9a1
   complexed with scn

Details for d2gx9b_

PDB Entry: 2gx9, 2.1 Å

PDB Description: x-ray structure of influenza virus ns1 effector domain

PDB Compounds: (B:) NS1 Effector Domain

SCOPe Domain Sequences for d2gx9b_:

Sequence; same for both SEQRES and ATOM records:

>d2gx9b_ d.299.1.1 (B:) Non-structural protein NS1 C-terminal domain {Influenza A virus, different strains [TaxId: 11320]}
asryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvligglewndntvrvsetlqrfawrs
sn

Timeline for d2gx9b_:

• d2gx9b_ first appeared in SCOP 1.73, called d2gx9b1
  
• d2gx9b_ appears in SCOPe 2.07