Lineage for d3eb2d_ (3eb2 D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1148735Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1148736Protein automated matches [190115] (32 species)
    not a true protein
  7. 1148917Species Rhodopseudomonas palustris [TaxId:1076] [188556] (2 PDB entries)
  8. 1148922Domain d3eb2d_: 3eb2 D: [174812]
    automated match to d1xkya1
    complexed with pge

Details for d3eb2d_

PDB Entry: 3eb2 (more details), 2.04 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 2.0a resolution
PDB Compounds: (D:) Putative dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3eb2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb2d_ c.1.10.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
dfhgvfpylvspvdaegrvradvmgrlcddliqagvhgltplgstgefaylgtaqreavv
ratieaaqrrvpvvagvastsvadavaqaklyeklgadgilaileayfplkdaqiesyfr
aiadaveipvviytnpqfqrsdltldviarlaehpriryikdastntgrllsiinrcgda
lqvfsasahipaavmliggvgwmagpaciaprqsvalyelckaqrwdealmlqrklwrvn
eafakfnlaacikaglalqgydvgdpippqaaltaeerkavekvlaeiae

SCOPe Domain Coordinates for d3eb2d_:

Click to download the PDB-style file with coordinates for d3eb2d_.
(The format of our PDB-style files is described here.)

Timeline for d3eb2d_: