SCOPe 2.02: Domain d3eb2d_: 3eb2 D:

Lineage for d3eb2d_ (3eb2 D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (32 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [188556] (2 PDB entries)

8. Domain d3eb2d_: 3eb2 D: [174812]
   automated match to d1xkya1
   complexed with pge

Details for d3eb2d_

PDB Entry: 3eb2, 2.04 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 2.0a resolution

PDB Compounds: (D:) Putative dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3eb2d_:

Sequence; same for both SEQRES and ATOM records:

>d3eb2d_ c.1.10.0 (D:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
dfhgvfpylvspvdaegrvradvmgrlcddliqagvhgltplgstgefaylgtaqreavv
ratieaaqrrvpvvagvastsvadavaqaklyeklgadgilaileayfplkdaqiesyfr
aiadaveipvviytnpqfqrsdltldviarlaehpriryikdastntgrllsiinrcgda
lqvfsasahipaavmliggvgwmagpaciaprqsvalyelckaqrwdealmlqrklwrvn
eafakfnlaacikaglalqgydvgdpippqaaltaeerkavekvlaeiae

Timeline for d3eb2d_:

• d3eb2d_ first appeared in SCOPe 2.01
  
• d3eb2d_ appears in SCOPe 2.03
  
• d3eb2d_ appears in the current release, SCOPe 2.08, called d3eb2d1