Lineage for d3eaja_ (3eaj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2798138Species SARS coronavirus [TaxId:227859] [187411] (13 PDB entries)
  8. 2798160Domain d3eaja_: 3eaj A: [174805]
    automated match to d1uj1b_
    mutant

Details for d3eaja_

PDB Entry: 3eaj (more details), 2.7 Å

PDB Description: crystal structure of sars-cov main protease quadruple mutant stif/a with two molecules in one asymmetric unit
PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3eaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaja_ b.47.1.4 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgaaaledeatpfdvvrqc
sg

SCOPe Domain Coordinates for d3eaja_:

Click to download the PDB-style file with coordinates for d3eaja_.
(The format of our PDB-style files is described here.)

Timeline for d3eaja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eajb_