Lineage for d3eaab_ (3eaa B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434048Fold b.157: Hcp1-like [141451] (1 superfamily)
    barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus
  4. 2434049Superfamily b.157.1: Hcp1-like [141452] (2 families) (S)
    probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets
  5. 2434056Family b.157.1.0: automated matches [191591] (1 protein)
    not a true family
  6. 2434057Protein automated matches [191065] (5 species)
    not a true protein
  7. 2434066Species Edwardsiella tarda [TaxId:636] [188963] (1 PDB entry)
  8. 2434068Domain d3eaab_: 3eaa B: [174798]
    automated match to d1y12a1

Details for d3eaab_

PDB Entry: 3eaa (more details), 2.79 Å

PDB Description: Structure of a type six secretion system protein
PDB Compounds: (B:) EvpC

SCOPe Domain Sequences for d3eaab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaab_ b.157.1.0 (B:) automated matches {Edwardsiella tarda [TaxId: 636]}
afdtyikldkvdgestddkhkkwievlgfawgagnectmesgtqglntgkammsvlrvtk
wmdcasvklasaavqgqnfptleleictqagdkfafciykfthvavssyqcsgatggsdr
pqetidfaykevtweyvpqdqngkaggkigpegwslitnkkk

SCOPe Domain Coordinates for d3eaab_:

Click to download the PDB-style file with coordinates for d3eaab_.
(The format of our PDB-style files is described here.)

Timeline for d3eaab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3eaaa_