Class b: All beta proteins [48724] (177 folds) |
Fold b.157: Hcp1-like [141451] (1 superfamily) barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus |
Superfamily b.157.1: Hcp1-like [141452] (2 families) probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets |
Family b.157.1.0: automated matches [191591] (1 protein) not a true family |
Protein automated matches [191065] (5 species) not a true protein |
Species Edwardsiella tarda [TaxId:636] [188963] (1 PDB entry) |
Domain d3eaab_: 3eaa B: [174798] automated match to d1y12a1 |
PDB Entry: 3eaa (more details), 2.79 Å
SCOPe Domain Sequences for d3eaab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eaab_ b.157.1.0 (B:) automated matches {Edwardsiella tarda [TaxId: 636]} afdtyikldkvdgestddkhkkwievlgfawgagnectmesgtqglntgkammsvlrvtk wmdcasvklasaavqgqnfptleleictqagdkfafciykfthvavssyqcsgatggsdr pqetidfaykevtweyvpqdqngkaggkigpegwslitnkkk
Timeline for d3eaab_: