Lineage for d3e9tb1 (3e9t B:442-552)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2376572Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2376588Family b.1.27.0: automated matches [191575] (1 protein)
    not a true family
  6. 2376589Protein automated matches [191010] (2 species)
    not a true protein
  7. 2376590Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries)
  8. 2376592Domain d3e9tb1: 3e9t B:442-552 [174780]
    Other proteins in same PDB: d3e9ta2, d3e9tb2, d3e9tc2
    automated match to d2fwsa1
    complexed with ca

Details for d3e9tb1

PDB Entry: 3e9t (more details), 1.6 Å

PDB Description: Crystal structure of Apo-form Calx CBD1 domain
PDB Compounds: (B:) Na/Ca exchange protein

SCOPe Domain Sequences for d3e9tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9tb1 b.1.27.0 (B:442-552) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
irmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkgllsfp
pgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmilddd

SCOPe Domain Coordinates for d3e9tb1:

Click to download the PDB-style file with coordinates for d3e9tb1.
(The format of our PDB-style files is described here.)

Timeline for d3e9tb1: