| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.27: CalX-like [141072] (2 families) ![]() |
| Family b.1.27.0: automated matches [191575] (1 protein) not a true family |
| Protein automated matches [191010] (2 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [188762] (3 PDB entries) |
| Domain d3e9tb1: 3e9t B:442-552 [174780] Other proteins in same PDB: d3e9ta2, d3e9tb2, d3e9tc2 automated match to d2fwsa1 complexed with ca |
PDB Entry: 3e9t (more details), 1.6 Å
SCOPe Domain Sequences for d3e9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9tb1 b.1.27.0 (B:442-552) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
irmyfepghytvmencgefevrvvrrgdistyasveyetqdgtasagtdfvgrkgllsfp
pgvdeqrfrievidddvfeedecfyirlfnpsegvklavpmiatvmilddd
Timeline for d3e9tb1: