Lineage for d3e7ba1 (3e7b A:7-299)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2232001Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2232027Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 2232028Species Human (Homo sapiens) [TaxId:9606] [188651] (5 PDB entries)
  8. 2232033Domain d3e7ba1: 3e7b A:7-299 [174711]
    Other proteins in same PDB: d3e7ba2, d3e7bb2
    automated match to d1fjma_
    complexed with azi, cl, e7b, gol, mn, na

Details for d3e7ba1

PDB Entry: 3e7b (more details), 1.7 Å

PDB Description: crystal structure of protein phosphatase-1 bound to the natural toxin inhibitor tautomycin
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3e7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e7ba1 d.159.1.3 (A:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d3e7ba1:

Click to download the PDB-style file with coordinates for d3e7ba1.
(The format of our PDB-style files is described here.)

Timeline for d3e7ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e7ba2